| Detail-Interactions: | |
| RAID ID: | RRI00000095 |
|---|---|
| RNA/Protein Symbol 1: | IGF2-AS |
| RNA/Protein Category 1: | lncRNA |
| RNA/Protein Symbol 2: | IGF2 mRNA |
| RNA/Protein Category 2: | mRNA |
| Validated Method: | |
| Tissue: | |
| PMID: | 12702581 |
| Detail description: | We have examined the expression of IGF2 and IGF2-AS in normal tissue, breast and ovarian tumors, and 25 informative, well-characterized Wilms` tumors and determined the relationship between IGF2 and IGF2-AS imprinting. |
| The Predicated Binding Sites between IGF2-AS and IGF2 | |||||
| By miRanda | Structure | Match Score | Energy Score | IGF2-AS Location | IGF2 Location |
| The Predicated Binding Sites between IGF2-AS and IGF2 | ||||
| By RIsearch | Structure | IGF2-AS Location | IGF2 Location | Score |
| The Predicated Binding Sites of IGF2 | |
| RBPBD | |
| RsiteDB | |
| BindN |
>sp|P01344|IGF2_HUMAN Insulin-like growth factor II OS=Homo sapiens GN=IGF2 PE=1 SV=1 Sequence: MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS Prediction: ------+-------------------+-+------------------+--+-++--++++ Confidence: 888455727789969998938655527362256777887595777976455557228978 Sequence: RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK Prediction: ++++--------+------------++++++++-++--+-------+----+-------+ Confidence: 985846877879457776897435667686585464324675525473474565424226 Sequence: QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Prediction: +++++-++------+-++-+---------+-+++-+-----------+--------++++ Confidence: 778783885623368587474573785755247728365574324345334332236576 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| BindN+ |
>sp|P01344|IGF2_HUMAN Insulin-like growth factor II OS=Homo sapiens GN=IGF2 PE=1 SV=1 Sequence: MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS Prediction: -----++-------------------------+--+--+-------------++---+++ Confidence: 327243425789999998999788765773323113755695897842312334332535 Sequence: RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK Prediction: ++++---------------------++-++-+--+--------+--+----+-------+ Confidence: 864634755244242255597224543374272331223674344252134423123217 Sequence: QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Prediction: +++++-++--+---+-++-++--+--------++-+-----------+-------+++++ Confidence: 476691881333367396274463385861634325454485412235122434155356 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| RNAbindR |
>P01344|IGF2 Sequence: MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS Prediction: -+++++++--------------------------++----------------++++++++ Confidence: 355857752011000000000000001003432156000000000013422167677769 Sequence: RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK Prediction: +++++----------------------------------------------+++++++++ Confidence: 989772234411412102101223120121121021330100011211321766887879 Sequence: QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Prediction: ++++++++++++++++++++++-++----------+--------------------+-++ Confidence: 998999999899999899888926614020023248423412243123020111015256 Sequence: Prediction: - Confidence: 0 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| Pprint |
Sequence: MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS Prediction: -++++----------------------------------------+-++---++++++++ Confidence: 234440222000000000000000000000000000000000000403412059899999 Sequence: RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK Prediction: ++++++--++++-----+----+--+--+--+-------------------+--+--+++ Confidence: 996977225444310103001043143141353230023201000003110512522367 Sequence: QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK Prediction: +++++++++++++-++++++++++---------+-+-+-----------+---+-+---+ Confidence: 888577895654524598597434211013203425230000030112243323242333 Sequence: Prediction: Confidence: ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.