Detail-Interactions: | |
RAID ID: | RRI00000065 |
---|---|
RNA/Protein Symbol 1: | alpha-250 |
RNA/Protein Category 1: | lncRNA |
RNA/Protein Symbol 2: | RPS14 mRNA |
RNA/Protein Category 2: | mRNA |
Validated Method: | RNase protection assay assay |
Tissue: | HT1080 cells//HeLa S3 cells//CCRF-CEM cells//HL-60 cells |
PMID: | 7867928 |
Detail description: | Tissue culture transfection and cell-free transcription experiments demonstrate that alpha-250 and alpha-280 stimulate S14 mRNA transcription, whereas free ribosomal protein S14 inhibits it. |
The Predicated Binding Sites between alpha-250 and RPS14 | |||||
By miRanda | Structure | Match Score | Energy Score | alpha-250 Location | RPS14 Location |
The Predicated Binding Sites between alpha-250 and RPS14 | ||||
By RIsearch | Structure | alpha-250 Location | RPS14 Location | Score |
Query: 3' CCCCUCGCCGCAGGAUGCCCCCCGAUUGUCGCGCCCGGGC 5' |||||||||||||||||||||||||||||||||||||||| Target: 5' GGGGAGCGGCGUCCUACGGGGGGCUAACAGCGCGGGCCCG 3' |
217-256 | 62-101 | -102.31 | |
The Predicated Binding Sites of RPS14 | |
RBPBD | |
RsiteDB | |
BindN |
>sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens GN=RPS14 PE=1 SV=3 Sequence: MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGM Prediction: ---+++++++-------------------------------------+-+-+--+-+--- Confidence: 442998988643278376447649749799979894967479895474552547585333 Sequence: KVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALA Prediction: +-+--+-++--+-----------+-+---------+-+-++++++++++++-++--+--- Confidence: 728428267234575989465534753768266275873886999987785376458345 Sequence: RSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL Prediction: ++--+--+-------+++++++++++++++- Confidence: 8523845786683455898899999997993 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
BindN+ |
>sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens GN=RPS14 PE=1 SV=3 Sequence: MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGM Prediction: ++++++++++++++++++++++++++-----+-+-+-++-+-+-----+++-----++-+ Confidence: 748987989856644745686355536331966357366357592231354442113614 Sequence: KVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALA Prediction: +-++++++++++---------------------+-+-+-+++++++++++++-+--+--- Confidence: 629769488665361788427724714436227465652443544886664416666454 Sequence: RSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL Prediction: +------------++++++++++++++++++ Confidence: 7256353275161345868899999999994 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
RNAbindR |
>P62263|RPS14 Sequence: MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGM Prediction: +++++++--------+---------------+---+-----------+------++++++ Confidence: 899987614401333533331300211010062425134100203415442411756777 Sequence: KVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALA Prediction: +++++++++++++-++-----------------+++-+++++++++++++++++++++-- Confidence: 768665555768846542220001000201433759397989999999897688758611 Sequence: RSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL Prediction: +---+--+----+++++++++++++++++++- Confidence: 81435128143288889999999999999970 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
Pprint |
Sequence: MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGM Prediction: ++++++++++++++++++++++++++++++-++++++++--------++--+-+--++++ Confidence: 569999965867677999884566665946393867747030100203422413017899 Sequence: KVKADRDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALA Prediction: +++++++++++++------+------++++++-+-+-+-----+++++++++++--+++- Confidence: 789759697876501000030012036466551406141021244989998956125452 Sequence: RSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL Prediction: +-++---+----+++++++++++++++++++ Confidence: 6147222512114847999999999999999 ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.