| Detail-Interactions: | |
| RAID ID: | RPI00001612 |
|---|---|
| RNA/Protein Symbol 1: | TERC(htr) |
| RNA/Protein Category 1: | snoRNA |
| RNA/Protein Symbol 2: | NME4 |
| RNA/Protein Category 2: | Protein |
| Validated Method: | quantitative fluorescent reverse transcription polymerase chain reaction |
| Tissue: | bladder cancer cell line biu-101 |
| PMID: | 20556588 |
| Detail description: | The effects of combined RNA interference (RNAi) of human telomerase RNA (hTR) and human telomerase reverse transcriptase (hTERT) genes on telomerase activity in a bladder cancer cell line (BIU-87 cells) were investigated by using gene chip technology in vitro with an attempt to evaluate the role of RNAi in the gene therapy of bladder transitional cell cancer (BTCC). HTR-siRNA and hTERT-siRNA, especially their combination, siRNA hTR+hTERT, specifically and effectively suppressed the expression of both hTR and hTERT mRNA and telomerase activity. Gene chip analysis revealed that 21 genes were down-regulated (ATM, BAX, BCL2, BCL2L1, BIRC5, CD44, CTNNB1, E2F1, JUN, MCAM, MTA1, MYC, NFKB1, NFKBIA, NME4, PNN, PNN, SERPINE1, THBS1, TNFRSF1A, and UCC1). |
| The Predicated Binding Sites between TERC and NME4 | |||||
| By miRanda | Structure | Match Score | Energy Score | TERC Location | NME4 Location |
| The Predicated Binding Sites between TERC and NME4 | ||||
| By RIsearch | Structure | TERC Location | NME4 Location | Score |
| The Predicated Binding Sites of NME4 | |
| RBPBD | |
| RsiteDB | |
| BindN |
>sp|O00746|NDKM_HUMAN Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens GN=NME4 PE=1 SV=1 Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR Prediction: ------+---+--+-++++++-+---+--++++++++-+-----+--+-++--------+ Confidence: 886896535683492569564264576347678875736355475424445289459944 Sequence: FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS Prediction: --++--+---------------------+++--+-------++--------------+-+ Confidence: 648545538883783876487765322577624528792454454888897894465875 Sequence: RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ Prediction: +-------+----+-+-+--------+---------+---+------------------+ Confidence: 752432345424353557546264747577384636435265848495334873495345 Sequence: HSSIHPA Prediction: -++---- Confidence: 2557236 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| BindN+ |
>sp|O00746|NDKM_HUMAN Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens GN=NME4 PE=1 SV=1 Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR Prediction: ------+---+--+-+++-----------++-++----+-------+---+--------+ Confidence: 423544525847364335413735562224414522333344351232325286247733 Sequence: FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS Prediction: --++-------+--+-------------+-+-----------+-+------------+-- Confidence: 627615212345543853798687123132422346683561524225487645364426 Sequence: RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ Prediction: +---+++----------+---------+--+--++------------------------- Confidence: 742243411423853256235273684425611435226757638583896799696595 Sequence: HSSIHPA Prediction: --+---- Confidence: 3236123 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| RNAbindR |
>O00746|NME4 Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR Prediction: ++++++++--+--+-+++------------------+-+-+---+++++++++--+--++ Confidence: 578676953473354667442314202311113123536451326588769761374268 Sequence: FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS Prediction: -+++-+++-+++------------------+++++-------+-+-++--++-++--++- Confidence: 269948854558213124210011113132666564224412546465345545522651 Sequence: RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ Prediction: +---+--+----+-++-+++---+--+++++++++--+---------------------- Confidence: 834273473244546848573317118655957764453341141112002000000000 Sequence: HSSIHPA Prediction: -------- Confidence: 00103120 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| Pprint |
Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQR Prediction: ---+--+---+--++++++-----------++-++---------+++-+-++---+---+ Confidence: 112300430030035585400131001020552531101000307682306620130006 Sequence: FERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRAS Prediction: --++++++--+++++---------------------------+++-----------+--- Confidence: 017944562337367010000000000000210001000002736010000023204110 Sequence: RAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQ Prediction: +--++++++----------+-+-+--+---+-+++------------------------- Confidence: 711595877210000102033404206202737550110000000000000000000000 Sequence: HSSIHPA Prediction: ------- Confidence: 3000122 ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.