The Detail Information for This Interaction


  • Detail
  • Binding
  • Network
Detail-Interactions:
RAID ID: RPI00001602
RNA/Protein Symbol 1:TERC(htr)
RNA/Protein Category 1: snoRNA
RNA/Protein Symbol 2: BIRC5
RNA/Protein Category 2: Protein
Validated Method: quantitative fluorescent reverse transcription polymerase chain reaction
Tissue: bladder cancer cell line biu-91 
PMID: 20556588 
Detail description:

The effects of combined RNA interference (RNAi) of human telomerase RNA (hTR) and human telomerase reverse transcriptase (hTERT) genes on telomerase activity in a bladder cancer cell line (BIU-87 cells) were investigated by using gene chip technology in vitro with an attempt to evaluate the role of RNAi in the gene therapy of bladder transitional cell cancer (BTCC). HTR-siRNA and hTERT-siRNA, especially their combination, siRNA hTR+hTERT, specifically and effectively suppressed the expression of both hTR and hTERT mRNA and telomerase activity. Gene chip analysis revealed that 21 genes were down-regulated (ATM, BAX, BCL2, BCL2L1, BIRC5, CD44, CTNNB1, E2F1, JUN, MCAM, MTA1, MYC, NFKB1, NFKBIA, NME4, PNN, PNN, SERPINE1, THBS1, TNFRSF1A, and UCC1).  

The Predicated Binding Sites between TERC and BIRC5
By miRanda Structure Match Score Energy Score TERC Location BIRC5 Location
The Predicated Binding Sites between TERC and BIRC5
By RIsearch Structure TERC Location BIRC5 Location Score
The Predicated Binding Sites of BIRC5
RBPBD
RsiteDB
BindN
>sp|O15392|BIRC5_HUMAN Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens GN=BIRC5 PE=1 SV=3

Sequence:    MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
Prediction:  -----------------+--+------------+--+-----------------------
Confidence:  666425348447693756624536588988765445567488573542546578959899

Sequence:    FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
Prediction:  -----------------+++++-------+------------+--+++-+++--++++++
Confidence:  958967467788674526566633536274237559598676562758287634868878

Sequence:    KKEFEETAKKVRRAIEQLAAMD
Prediction:  ++------++-++---------
Confidence:  7623233456688686499988


*** Prediction:  binding residues are labeled with '+' and in red;
                 non-binding residues labeled with '-' and in green.
*** Confidence:  from level 0 (lowest) to level 9 (highest).


BindN+
>sp|O15392|BIRC5_HUMAN Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens GN=BIRC5 PE=1 SV=3

Sequence:    MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
Prediction:  -----------------+------------------------------------------
Confidence:  226225234378365753861226347888887468678376674542226647557763

Sequence:    FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
Prediction:  ----------------+-+--+-----------------------------------+--
Confidence:  465627286566123341412325867563246869798788497553623467283345

Sequence:    KKEFEETAKKVRRAIEQLAAMD
Prediction:  ----------------------
Confidence:  5474865724722496577788


*** Prediction:  binding residues are labeled with '+' and in red;
                 non-binding residues labeled with '-' and in green.
*** Confidence:  from level 0 (lowest) to level 9 (highest).

RNAbindR
>O15392|BIRC5
Sequence:    MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
Prediction:  --------------------++--+---+-+--+--+---+++-+--------+-++---
Confidence:  122211222120000004035544842254531544722457727212244335375233

Sequence:    FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
Prediction:  --+-+--+--------+-++++++-+----------------------------------
Confidence:  346254452123323454986667262222411000000200000001000200200000

Sequence:    KKEFEETAKKVRRAIEQLAAMD
Prediction:  -----------------------
Confidence:  00000000000000001012110

*** Prediction:  binding residues are labeled with '+' and in red;
                 non-binding residues labeled with '-' and in green.
*** Confidence:  from level 0 (lowest) to level 9 (highest).
                 
Pprint
Sequence:    MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNI
Prediction:  --++-+--+------------+------+----------------------------++-
Confidence:  213534225001100000000401211243000000000000000000222132123441

Sequence:    HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK
Prediction:  -------------------------------+++--------------------------
Confidence:  200000000010001000000000000002034430200020102110020000000000

Sequence:    MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
Prediction:  -------++---+-----------------------------------------------
Confidence:  003022343122501131000000110000000010000000000012022211100101

Sequence:    CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
Prediction:  ------------------------------------------------------------
Confidence:  210021210000000000000000100002002220000000000010000000000000

Sequence:    VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
Prediction:  -------+---------+--------------+-------+-------------------
Confidence:  100013232220000023012121100000024001000041000000030100000000

Sequence:    QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
Prediction:  --------------------------------------+-------------------++
Confidence:  001021000011000000000000000000011133124012000000002000000233

Sequence:    RKs194359942394369194475953336294354153437196822236451128323
Prediction:  ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++
Confidence:  744444444444444444444444444444444444444444444444444444444444

Sequence:    256585643882964416492675665191688719895341945734645451119764
Prediction:  ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++
Confidence:  444444444444444444444444444444444444444444444444444444444444

Sequence:    497789213177875855933974262131133119977996699993322446644775
Prediction:  ++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++
Confidence:  444444444444444444444444444444444444444444444444444444444444

Sequence:    55511991144228
Prediction:  ++++++++++++++
Confidence:  44444444444444

***Prediction:  binding residues are labeled with '+' and in red;
                 non-binding residues labeled with '-' and in green.
***Confidence:  from level 0 (lowest) to level 9 (highest).
                 
Visualization:
Select the center nodes: First Node Second Node Both the Nodes
Select the Level of Neighbour: First Neighbour Second Neighbour

The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node, the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node, the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node. Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.


The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.