| Detail-Interactions: | |
| RAID ID: | RPI00001594 |
|---|---|
| RNA/Protein Symbol 1: | RNU7-1(U7) |
| RNA/Protein Category 1: | snoRNA |
| RNA/Protein Symbol 2: | LSM10(Lsm10) |
| RNA/Protein Category 2: | Protein |
| Validated Method: | Immunoprecipitation |
| Tissue: | HeLa cells |
| PMID: | 11574479 |
| Detail description: | Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein. |
| The Predicated Binding Sites between RNU7-1 and LSM10 | |||||
| By miRanda | Structure | Match Score | Energy Score | RNU7-1 Location | LSM10 Location |
| The Predicated Binding Sites between RNU7-1 and LSM10 | ||||
| By RIsearch | Structure | RNU7-1 Location | LSM10 Location | Score |
| The Predicated Binding Sites of LSM10 | |
| RBPBD | LSmx1 |
| RsiteDB | |
| BindN |
>sp|Q969L4|LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens GN=LSM10 PE=1 SV=1 Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT Prediction: ----++-+-++---------------+-++---+-------+----------+--+-+++ Confidence: 878256462456255499999465246657466567363256852979687957775764 Sequence: DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK Prediction: -+--+-----------+--+------------+-----------++--++++++------ Confidence: 262442829959693572682759799848224863696775296422596748333332 Sequence: NCK Prediction: +-+ Confidence: 447 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| BindN+ |
>sp|Q969L4|LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens GN=LSM10 PE=1 SV=1 Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT Prediction: ---+++-+-+----------------------------------+-------+--+---- Confidence: 435544544426433599899569674862637247257241733737262838848322 Sequence: DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK Prediction: -++-----------+-+--++-+------------------++-+++++++++++----+ Confidence: 364413869869373462745536665839462984796653578855787648722216 Sequence: NCK Prediction: +-+ Confidence: 618 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| RNAbindR |
>Q969L4|LSM10 Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT Prediction: ------++-++++++++-+--++--++--+-+-+--------------+-+--------+ Confidence: 224134664757768863921751365215351740320222014241517221420315 Sequence: DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK Prediction: -+++++++----+-+++++++-+---------------++++++++++++++++++++++ Confidence: 367787550243749798788261434230020001106758888888998999999999 Sequence: NCK Prediction: +++- Confidence: 9990 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
| Pprint |
Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT Prediction: -+++++---------------+-------+---+------++------+---+-----++ Confidence: 243543120210002000000303011004030520120144003223420040000254 Sequence: DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK Prediction: ++++-++---------+--+--+-------------------+-++++++++-+++-+-- Confidence: 677425300130200130240041120130020001000003608869994739353513 Sequence: NCK Prediction: +++ Confidence: 634 ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.