Detail-Interactions: | |
RAID ID: | RPI00000470 |
---|---|
RNA/Protein Symbol 1: | MIRLET7A2(let-7) |
RNA/Protein Category 1: | miRNA |
RNA/Protein Symbol 2: | LIN28A(Lin28) |
RNA/Protein Category 2: | Protein |
Validated Method: | Quantitative real-time PCR |
Tissue: | |
PMID: | 23291449 |
Detail description: | Lin28 and Lin28b are related RNA-binding proteins that inhibit the maturation of miRNAs of the let-7 family and participate in the control of cellular stemnessand early embryonic development. |
The Predicated Binding Sites between MIRLET7A2 and LIN28A | |||||
By miRanda | Structure | Match Score | Energy Score | MIRLET7A2 Location | LIN28A Location |
Query: 3' uugAUAUGUUGGA-----UGAUGGAGu 5' |: |||:||| |||||||| Ref: 5' gagUGCACAGCCUAUUGAACUACCUCa 3' |
154.00 | -24.38 | 2-20 | 886-912 | |
Query: 3' uugauAUGUUGGAUGAUGGAGu 5' |:||:||| ||:|||| Ref: 5' cucacUGCAGCCU-CUGCCUCu 3' |
147.00 | -23.01 | 2-18 | 2154-2174 | |
Query: 3' uugauaugUUGGAUGAUGGAGu 5' | :|| ||:|||| Ref: 5' uucaagugAUUCUCCUGCCUCa 3' |
134.00 | -17.26 | 2-15 | 2179-2200 |
The Predicated Binding Sites between MIRLET7A2 and LIN28A | ||||
By RIsearch | Structure | MIRLET7A2 Location | LIN28A Location | Score |
Query: 3' UGAGGUAGU-----AGGUUGU---------AUAGUU 5' ||||||||| |||:||| |||||| Target: 5' ACUCCAUCAAGUUAUCCGACACGUGAGGUUUAUCAA 3' |
1-22 | 877-912 | -21.71 |
The Predicated Binding Sites of LIN28A | |
RBPBD | CSDx1, Znf_CCHCx2 |
RsiteDB | |
BindN |
>sp|Q9H9Z2|LN28A_HUMAN Protein lin-28 homolog A OS=Homo sapiens GN=LIN28A PE=1 SV=1 Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA Prediction: --+-----------+--------------+------------------------------ Confidence: 565513334535557563575577466667555775884876772586928958691527 Sequence: RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS Prediction: +----------------+------+------------++--+-----+-----------+ Confidence: 766778767989595425732445525267689483556246132178614445745436 Sequence: ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ Prediction: -+++++++++++++++++-----------+--+-+-+-++----------------+-++ Confidence: 199898999999999779412655633375366451628652343484378816247467 Sequence: GPSAQGKPTYFREEEEEIHSPTLLPEAQN Prediction: -+++++++++-+----------------- Confidence: 27859586665557765843437634833 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
BindN+ |
>sp|Q9H9Z2|LN28A_HUMAN Protein lin-28 homolog A OS=Homo sapiens GN=LIN28A PE=1 SV=1 Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA Prediction: --+-+-------------------------------------+-++------+-+----- Confidence: 313232278789872895775466444483787887882842445531522245362457 Sequence: RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS Prediction: -----------------+------+----------------++-+--------------+ Confidence: 277678888879293613522422633378879898742247434241824453324324 Sequence: ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ Prediction: +++++++++++++++++++++-+--++-+++++++++++++++++++++--+--+++--+ Confidence: 568654665667758889687131246138448785579657635434633423445215 Sequence: GPSAQGKPTYFREEEEEIHSPTLLPEAQN Prediction: -++++-+---------------------- Confidence: 16445261126357764612334756812 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
RNAbindR |
>Q9H9Z2|LIN28A Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA Prediction: --+-----------------------------------+-+++++++++++++++-+--- Confidence: 135011211224214100000001102211000011038466759869599886736420 Sequence: RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS Prediction: -------------------+++--++---------------------+-+++-+++++++ Confidence: 100000111011302322265834763110211001001013324337277648986889 Sequence: ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ Prediction: ++++++++++++++++++++--+--+++--+++++++++++++-++-++--+----+--+ Confidence: 999999999999898766653354275644565777779988646505622544445346 Sequence: GPSAQGKPTYFREEEEEIHSPTLLPEAQN Prediction: +++++-+----------------------- Confidence: 688684643101000000100000010230 *** Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. *** Confidence: from level 0 (lowest) to level 9 (highest). |
Pprint |
Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA Prediction: ----------+++------------------------------------++++-+-+--- Confidence: 313000233136423000000000000002000001000000000000035441423301 Sequence: RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS Prediction: ---------------------+-+-----------+--+--+++-+-+-+---++----- Confidence: 200100000000000110022324211200000123014133343424241224420001 Sequence: ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ Prediction: -+++++++++++++++++++-+++-+---------++++-----+-------+------- Confidence: 267799999998989699863457232202123124464310034212100041202132 Sequence: GPSAQGKPTYFREEEEEIHSPTLLPEAQN Prediction: ++--------------------------- Confidence: 34333131132000000000000011012 ***Prediction: binding residues are labeled with '+' and in red; non-binding residues labeled with '-' and in green. ***Confidence: from level 0 (lowest) to level 9 (highest). |
The 'First Node' or 'Second Node' option represents the sub-network of interacting RNA/Protein with the first or second interaction node,
the 'Both the Nodes' option represents the sub-network of interacting RNA/Protein with both of interaction nodes.
The 'First Neighbour' represents the sub-network of direct interacting with the center node,
the 'Second Neighbour' represents the sub-network of direct or second step interacting with the center node.
Interaction sub-network based on the two nodes of this interaction may help the researchers represents all interacting partners immediately.
The Detail page: representing the detail information for RNA-RNA/RNA-Protein interaction;
The Binding page: representing the predicted binding sites and/or constants.
The Network page: representing the interaction sub-network of interacting RNA/Protein.